Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IRF8 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IRF8 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003394-A01 |
| Product name: | IRF8 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IRF8. |
| Gene id: | 3394 |
| Gene name: | IRF8 |
| Gene alias: | H-ICSBP|ICSBP|ICSBP1|IRF-8 |
| Gene description: | interferon regulatory factor 8 |
| Genbank accession: | NM_002163 |
| Immunogen: | IRF8 (NP_002154, 122 a.a. ~ 218 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQ |
| Protein accession: | NP_002154 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | IFN-gamma activated JAK1 shifts CD40-induced cytokine profiles in human antigen-presenting cells toward high IL-12p70 and low IL-10 production.Conzelmann M, Wagner AH, Hildebrandt A, Rodionova E, Hess M, Zota A, Giese T, Falk CS, Ho AD, Dreger P, Hecker M, Luft T. Biochem Pharmacol. 2010 Aug 13. [Epub ahead of print] |