Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HYAL1 monoclonal antibody (M01), clone 2H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP |
More info about HYAL1 monoclonal antibody (M01), clone 2H7
| Brand: | Abnova |
| Reference: | H00003373-M01 |
| Product name: | HYAL1 monoclonal antibody (M01), clone 2H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HYAL1. |
| Clone: | 2H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3373 |
| Gene name: | HYAL1 |
| Gene alias: | HYAL-1|LUCA1|MGC45987|NAT6 |
| Gene description: | hyaluronoglucosaminidase 1 |
| Genbank accession: | NM_007312 |
| Immunogen: | HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
| Protein accession: | NP_009296 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HYAL1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |