Brand: | Abnova |
Reference: | H00003373-A01 |
Product name: | HYAL1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HYAL1. |
Gene id: | 3373 |
Gene name: | HYAL1 |
Gene alias: | HYAL-1|LUCA1|MGC45987|NAT6 |
Gene description: | hyaluronoglucosaminidase 1 |
Genbank accession: | NM_007312 |
Immunogen: | HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
Protein accession: | NP_009296 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Hyaluronan synthases and hyaluronidases in nasal polyps.Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS. Eur Arch Otorhinolaryngol. 2015 Dec 10. [Epub ahead of print] |