| Brand: | Abnova |
| Reference: | H00003373-A01 |
| Product name: | HYAL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HYAL1. |
| Gene id: | 3373 |
| Gene name: | HYAL1 |
| Gene alias: | HYAL-1|LUCA1|MGC45987|NAT6 |
| Gene description: | hyaluronoglucosaminidase 1 |
| Genbank accession: | NM_007312 |
| Immunogen: | HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
| Protein accession: | NP_009296 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Hyaluronan synthases and hyaluronidases in nasal polyps.Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS. Eur Arch Otorhinolaryngol. 2015 Dec 10. [Epub ahead of print] |