HTR2B polyclonal antibody (A01) View larger

HTR2B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR2B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HTR2B polyclonal antibody (A01)

Brand: Abnova
Reference: H00003357-A01
Product name: HTR2B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HTR2B.
Gene id: 3357
Gene name: HTR2B
Gene alias: 5-HT(2B)|5-HT2B
Gene description: 5-hydroxytryptamine (serotonin) receptor 2B
Genbank accession: NM_000867
Immunogen: HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Protein accession: NP_000858
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003357-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.27 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003357-A01-1-12-1.jpg
Application image note: HTR2B polyclonal antibody (A01), Lot # 050927JC01 Western Blot analysis of HTR2B expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTR2B polyclonal antibody (A01) now

Add to cart