Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HTR1B polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HTR1B polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003351-A01 |
| Product name: | HTR1B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HTR1B. |
| Gene id: | 3351 |
| Gene name: | HTR1B |
| Gene alias: | 5-HT1B|5-HT1DB|HTR1D2|HTR1DB|S12 |
| Gene description: | 5-hydroxytryptamine (serotonin) receptor 1B |
| Genbank accession: | NM_000863 |
| Immunogen: | HTR1B (NP_000854, 1 a.a. ~ 49 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK |
| Protein accession: | NP_000854 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Noncanonical Postsynaptic Transport Route for a GPCR Belonging to the Serotonin Receptor Family.Liebmann T, Kruusmagi M, Sourial-Bassillious N, Bondar A, Svenningsson P, Flajolet M, Greengard P, Scott L, Brismar H, Aperia A. J Neurosci. 2012 Dec 12;32(50):17998-8008. doi: 10.1523/JNEUROSCI.1804-12.2012. |