Brand: | Abnova |
Reference: | H00003350-A01 |
Product name: | HTR1A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HTR1A. |
Gene id: | 3350 |
Gene name: | HTR1A |
Gene alias: | 5-HT1A|5HT1a|ADRB2RL1|ADRBRL1 |
Gene description: | 5-hydroxytryptamine (serotonin) receptor 1A |
Genbank accession: | NM_000524 |
Immunogen: | HTR1A (NP_000515, 1 a.a. ~ 36 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ |
Protein accession: | NP_000515 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (30.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |