No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00003347-M01 |
Product name: | HTN3 monoclonal antibody (M01), clone 4G9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HTN3. |
Clone: | 4G9 |
Isotype: | IgG2b Kappa |
Gene id: | 3347 |
Gene name: | HTN3 |
Gene alias: | HIS2|HTN2|HTN5 |
Gene description: | histatin 3 |
Genbank accession: | BC009791 |
Immunogen: | HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN |
Protein accession: | AAH09791 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |