| Brand: | Abnova |
| Reference: | H00003347-M01 |
| Product name: | HTN3 monoclonal antibody (M01), clone 4G9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HTN3. |
| Clone: | 4G9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3347 |
| Gene name: | HTN3 |
| Gene alias: | HIS2|HTN2|HTN5 |
| Gene description: | histatin 3 |
| Genbank accession: | BC009791 |
| Immunogen: | HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN |
| Protein accession: | AAH09791 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |