No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003340-M01A |
| Product name: | NDST1 monoclonal antibody (M01A), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDST1. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3340 |
| Gene name: | NDST1 |
| Gene alias: | HSST|NST1 |
| Gene description: | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 |
| Genbank accession: | NM_001543 |
| Immunogen: | NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI |
| Protein accession: | NP_001534 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | NDST1 monoclonal antibody (M01A), clone 1G10 Western Blot analysis of NDST1 expression in A-549 ( Cat # L025V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |