| Brand: | Abnova |
| Reference: | H00003337-D01 |
| Product name: | DNAJB1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DNAJB1 protein. |
| Gene id: | 3337 |
| Gene name: | DNAJB1 |
| Gene alias: | HSPF1|Hdj1|Hsp40|Sis1 |
| Gene description: | DnaJ (Hsp40) homolog, subfamily B, member 1 |
| Genbank accession: | NM_006145 |
| Immunogen: | DNAJB1 (NP_006136.1, 1 a.a. ~ 340 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI |
| Protein accession: | NP_006136.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of DNAJB1 transfected lysate using anti-DNAJB1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DNAJB1 MaxPab mouse polyclonal antibody (B01) (H00003337-B01). |
| Applications: | IP |
| Shipping condition: | Dry Ice |