| Brand: | Abnova |
| Reference: | H00003336-M01 |
| Product name: | HSPE1 monoclonal antibody (M01), clone 4C11-B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HSPE1. |
| Clone: | 4C11-B11 |
| Isotype: | IgG1 kappa |
| Gene id: | 3336 |
| Gene name: | HSPE1 |
| Gene alias: | CPN10|GROES|HSP10 |
| Gene description: | heat shock 10kDa protein 1 (chaperonin 10) |
| Genbank accession: | BC023518 |
| Immunogen: | HSPE1 (AAH23518, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Protein accession: | AAH23518 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |