No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Brand: | Abnova |
Reference: | H00003315-M04 |
Product name: | HSPB1 monoclonal antibody (M04), clone 3G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPB1. |
Clone: | 3G3 |
Isotype: | IgG2a Kappa |
Gene id: | 3315 |
Gene name: | HSPB1 |
Gene alias: | CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27 |
Gene description: | heat shock 27kDa protein 1 |
Genbank accession: | NM_001540 |
Immunogen: | HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Protein accession: | NP_001531 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged HSPB1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Shipping condition: | Dry Ice |