Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HSPB1 monoclonal antibody (M04), clone 3G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
More info about HSPB1 monoclonal antibody (M04), clone 3G3
| Brand: | Abnova |
| Reference: | H00003315-M04 |
| Product name: | HSPB1 monoclonal antibody (M04), clone 3G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPB1. |
| Clone: | 3G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3315 |
| Gene name: | HSPB1 |
| Gene alias: | CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27 |
| Gene description: | heat shock 27kDa protein 1 |
| Genbank accession: | NM_001540 |
| Immunogen: | HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
| Protein accession: | NP_001531 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HSPB1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
| Shipping condition: | Dry Ice |