HSPB1 polyclonal antibody (A01) View larger

HSPB1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HSPB1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003315-A01
Product name: HSPB1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant HSPB1.
Gene id: 3315
Gene name: HSPB1
Gene alias: CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene description: heat shock 27kDa protein 1
Genbank accession: NM_001540
Immunogen: HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Protein accession: NP_001531
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003315-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSPB1 polyclonal antibody (A01) now

Add to cart