No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003305-M01 |
| Product name: | HSPA1L monoclonal antibody (M01), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPA1L. |
| Clone: | 1B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3305 |
| Gene name: | HSPA1L |
| Gene alias: | HSP70-1L|HSP70-HOM|HSP70T|hum70t |
| Gene description: | heat shock 70kDa protein 1-like |
| Genbank accession: | NM_005527 |
| Immunogen: | HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
| Protein accession: | NP_005518 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |