| Brand: | Abnova |
| Reference: | H00003299-M05 |
| Product name: | HSF4 monoclonal antibody (M05), clone 2B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSF4. |
| Clone: | 2B3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3299 |
| Gene name: | HSF4 |
| Gene alias: | CTM |
| Gene description: | heat shock transcription factor 4 |
| Genbank accession: | NM_001538 |
| Immunogen: | HSF4 (NP_001529, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC |
| Protein accession: | NP_001529 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |