| Brand: | Abnova |
| Reference: | H00003297-A01 |
| Product name: | HSF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HSF1. |
| Gene id: | 3297 |
| Gene name: | HSF1 |
| Gene alias: | HSTF1 |
| Gene description: | heat shock transcription factor 1 |
| Genbank accession: | NM_005526 |
| Immunogen: | HSF1 (NP_005517, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS |
| Protein accession: | NP_005517 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HSF1 polyclonal antibody (A01), Lot # 051026JC01 Western Blot analysis of HSF1 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Aqueous Extract of Paeonia lactiflora and Paeoniflorin as Aggregation Reducers Targeting Chaperones in Cell Models of Spinocerebellar Ataxia 3.Chang KH, Chen WL, Lee LC, Lin CH, Kung PJ, Lin TH, Wu YC, Wu YR, Chen YC, Lee-Chen GJ, Chen CM. Evid Based Complement Alternat Med. 2013;2013:471659. doi: 10.1155/2013/471659. |