| Brand: | Abnova |
| Reference: | H00003294-D01P |
| Product name: | HSD17B2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HSD17B2 protein. |
| Gene id: | 3294 |
| Gene name: | HSD17B2 |
| Gene alias: | EDH17B2|HSD17|SDR9C2 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 2 |
| Genbank accession: | NM_002153.1 |
| Immunogen: | HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT |
| Protein accession: | NP_002144.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |