| Brand: | Abnova |
| Reference: | H00003293-A01 |
| Product name: | HSD17B3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HSD17B3. |
| Gene id: | 3293 |
| Gene name: | HSD17B3 |
| Gene alias: | EDH17B3|SDR12C2 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 3 |
| Genbank accession: | NM_000197 |
| Immunogen: | HSD17B3 (NP_000188, 29 a.a. ~ 119 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK |
| Protein accession: | NP_000188 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES. J Steroid Biochem Mol Biol. 2015 Jun;150:35-45. |