Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HSD11B1 monoclonal antibody (M02A), clone 2C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
More info about HSD11B1 monoclonal antibody (M02A), clone 2C10
| Brand: | Abnova |
| Reference: | H00003290-M02A |
| Product name: | HSD11B1 monoclonal antibody (M02A), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HSD11B1. |
| Clone: | 2C10 |
| Isotype: | IgM Kappa |
| Gene id: | 3290 |
| Gene name: | HSD11B1 |
| Gene alias: | 11-DH|11-beta-HSD1|HDL|HSD11|HSD11B|HSD11L|MGC13539|SDR26C1 |
| Gene description: | hydroxysteroid (11-beta) dehydrogenase 1 |
| Genbank accession: | BC012593 |
| Immunogen: | HSD11B1 (AAH12593, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
| Protein accession: | AAH12593 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in MCF-7. |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |