No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003280-M01 |
Product name: | HES1 monoclonal antibody (M01), clone 4D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HES1. |
Clone: | 4D9 |
Isotype: | IgG2b Kappa |
Gene id: | 3280 |
Gene name: | HES1 |
Gene alias: | FLJ20408|HES-1|HHL|HRY|bHLHb39 |
Gene description: | hairy and enhancer of split 1, (Drosophila) |
Genbank accession: | NM_005524 |
Immunogen: | HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH |
Protein accession: | NP_005515 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | HES1 monoclonal antibody (M01), clone 4D9 Western Blot analysis of HES1 expression in THP-1 ( Cat # L007V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |