No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,PLA-Ce |
Brand: | Abnova |
Reference: | H00003269-M03 |
Product name: | HRH1 monoclonal antibody (M03), clone 3D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HRH1. |
Clone: | 3D1 |
Isotype: | IgG1 Kappa |
Gene id: | 3269 |
Gene name: | HRH1 |
Gene alias: | H1-R|hisH1 |
Gene description: | histamine receptor H1 |
Genbank accession: | NM_000861 |
Immunogen: | HRH1 (NP_000852.1, 312 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA |
Protein accession: | NP_000852.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with anti-IL6 rabbit purified polyclonal 1:1200 and anti-HRH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |