| Brand: | Abnova |
| Reference: | H00003265-A01 |
| Product name: | HRAS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HRAS. |
| Gene id: | 3265 |
| Gene name: | HRAS |
| Gene alias: | C-BAS/HAS|C-H-RAS|C-HA-RAS1|CTLO|H-RASIDX|HAMSV|HRAS1|K-RAS|N-RAS|RASH1 |
| Gene description: | v-Ha-ras Harvey rat sarcoma viral oncogene homolog |
| Genbank accession: | CB565907 |
| Immunogen: | HRAS (AAH21566, 80 a.a. ~ 179 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPEESGP |
| Protein accession: | AAH21566 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Overexpression of DDX43 mediates MEK-Inhibitor Resistance through RAS up-regulation in Uveal Melanoma Cells.Ambrosini G, Khanin R, Carvajal RD, Schwartz GK Mol Cancer Ther. 2014 Jun 4. pii: molcanther.0095.2014. |