No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003265-A01 |
Product name: | HRAS polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HRAS. |
Gene id: | 3265 |
Gene name: | HRAS |
Gene alias: | C-BAS/HAS|C-H-RAS|C-HA-RAS1|CTLO|H-RASIDX|HAMSV|HRAS1|K-RAS|N-RAS|RASH1 |
Gene description: | v-Ha-ras Harvey rat sarcoma viral oncogene homolog |
Genbank accession: | CB565907 |
Immunogen: | HRAS (AAH21566, 80 a.a. ~ 179 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | CVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPEESGP |
Protein accession: | AAH21566 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Overexpression of DDX43 mediates MEK-Inhibitor Resistance through RAS up-regulation in Uveal Melanoma Cells.Ambrosini G, Khanin R, Carvajal RD, Schwartz GK Mol Cancer Ther. 2014 Jun 4. pii: molcanther.0095.2014. |