Brand: | Abnova |
Reference: | H00003242-M07 |
Product name: | HPD monoclonal antibody (M07), clone 2F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HPD. |
Clone: | 2F3 |
Isotype: | IgG2a Kappa |
Gene id: | 3242 |
Gene name: | HPD |
Gene alias: | 4-HPPD|4HPPD|GLOD3|PPD |
Gene description: | 4-hydroxyphenylpyruvate dioxygenase |
Genbank accession: | NM_002150 |
Immunogen: | HPD (NP_002141.1, 160 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIAL |
Protein accession: | NP_002141.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HPD monoclonal antibody (M07), clone 2F3. Western Blot analysis of HPD expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |