No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003237-M06 |
Product name: | HOXD11 monoclonal antibody (M06), clone 6D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXD11. |
Clone: | 6D8 |
Isotype: | IgG2a Kappa |
Gene id: | 3237 |
Gene name: | HOXD11 |
Gene alias: | HOX4|HOX4F |
Gene description: | homeobox D11 |
Genbank accession: | NM_021192 |
Immunogen: | HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR |
Protein accession: | NP_067015 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | HOXD11 monoclonal antibody (M06), clone 6D8 Western Blot analysis of HOXD11 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |