| Brand: | Abnova |
| Reference: | H00003237-M06 |
| Product name: | HOXD11 monoclonal antibody (M06), clone 6D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXD11. |
| Clone: | 6D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3237 |
| Gene name: | HOXD11 |
| Gene alias: | HOX4|HOX4F |
| Gene description: | homeobox D11 |
| Genbank accession: | NM_021192 |
| Immunogen: | HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR |
| Protein accession: | NP_067015 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HOXD11 monoclonal antibody (M06), clone 6D8 Western Blot analysis of HOXD11 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |