Brand: | Abnova |
Reference: | H00003235-M01 |
Product name: | HOXD9 monoclonal antibody (M01), clone 2A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXD9. |
Clone: | 2A9 |
Isotype: | IgG1 Kappa |
Gene id: | 3235 |
Gene name: | HOXD9 |
Gene alias: | HOX4|HOX4C|Hox-4.3|Hox-5.2 |
Gene description: | homeobox D9 |
Genbank accession: | NM_014213 |
Immunogen: | HOXD9 (NP_055028, 146 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAA* |
Protein accession: | NP_055028 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | HOXD9 monoclonal antibody (M01), clone 2A9 Western Blot analysis of HOXD9 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |