| Brand: | Abnova |
| Reference: | H00003234-M03 |
| Product name: | HOXD8 monoclonal antibody (M03), clone 5E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXD8. |
| Clone: | 5E11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3234 |
| Gene name: | HOXD8 |
| Gene alias: | HOX4|HOX4E|HOX5.4 |
| Gene description: | homeobox D8 |
| Genbank accession: | NM_019558 |
| Immunogen: | HOXD8 (NP_062458, 126 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR |
| Protein accession: | NP_062458 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HOXD8 monoclonal antibody (M03), clone 5E11 Western Blot analysis of HOXD8 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |