HOXD8 monoclonal antibody (M02), clone 3G8 View larger

HOXD8 monoclonal antibody (M02), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXD8 monoclonal antibody (M02), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HOXD8 monoclonal antibody (M02), clone 3G8

Brand: Abnova
Reference: H00003234-M02
Product name: HOXD8 monoclonal antibody (M02), clone 3G8
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXD8.
Clone: 3G8
Isotype: IgG2a Kappa
Gene id: 3234
Gene name: HOXD8
Gene alias: HOX4|HOX4E|HOX5.4
Gene description: homeobox D8
Genbank accession: NM_019558
Immunogen: HOXD8 (NP_062458, 126 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
Protein accession: NP_062458
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003234-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003234-M02-1-12-1.jpg
Application image note: HOXD8 monoclonal antibody (M02), clone 3G8 Western Blot analysis of HOXD8 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOXD8 monoclonal antibody (M02), clone 3G8 now

Add to cart