HOXD4 monoclonal antibody (M01), clone 1H7 View larger

HOXD4 monoclonal antibody (M01), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXD4 monoclonal antibody (M01), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HOXD4 monoclonal antibody (M01), clone 1H7

Brand: Abnova
Reference: H00003233-M01
Product name: HOXD4 monoclonal antibody (M01), clone 1H7
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXD4.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 3233
Gene name: HOXD4
Gene alias: HHO.C13|HOX-5.1|HOX4|HOX4B|Hox-4.2
Gene description: homeobox D4
Genbank accession: NM_014621
Immunogen: HOXD4 (NP_055436.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF
Protein accession: NP_055436.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003233-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003233-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HOXD4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOXD4 monoclonal antibody (M01), clone 1H7 now

Add to cart