Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXC13 monoclonal antibody (M01), clone 10D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about HOXC13 monoclonal antibody (M01), clone 10D4
| Brand: | Abnova |
| Reference: | H00003229-M01 |
| Product name: | HOXC13 monoclonal antibody (M01), clone 10D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXC13. |
| Clone: | 10D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3229 |
| Gene name: | HOXC13 |
| Gene alias: | HOX3|HOX3G |
| Gene description: | homeobox C13 |
| Genbank accession: | NM_017410 |
| Immunogen: | HOXC13 (NP_059106, 132 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK |
| Protein accession: | NP_059106 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HOXC13 monoclonal antibody (M01), clone 10D4 Western Blot analysis of HOXC13 expression in A-549 ( Cat # L025V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Palmitoylation Regulates Epidermal Homeostasis and Hair Follicle Differentiation.Mill P, Lee AW, Fukata Y, Tsutsumi R, Fukata M, Keighren M, Porter RM, McKie L, Smyth I, Jackson IJ. PLoS Genet. 2009 Nov;5(11):e1000748. Epub 2009 Nov 26. |