Brand: | Abnova |
Reference: | H00003228-M09 |
Product name: | HOXC12 monoclonal antibody (M09), clone 3E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXC12. |
Clone: | 3E1 |
Isotype: | IgG2a Kappa |
Gene id: | 3228 |
Gene name: | HOXC12 |
Gene alias: | HOC3F|HOX3|HOX3F |
Gene description: | homeobox C12 |
Genbank accession: | NM_173860 |
Immunogen: | HOXC12 (NP_776272, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA |
Protein accession: | NP_776272 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HOXC12 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |