HOXC10 monoclonal antibody (M01), clone 3F2 View larger

HOXC10 monoclonal antibody (M01), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXC10 monoclonal antibody (M01), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about HOXC10 monoclonal antibody (M01), clone 3F2

Brand: Abnova
Reference: H00003226-M01
Product name: HOXC10 monoclonal antibody (M01), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXC10.
Clone: 3F2
Isotype: IgG2a Kappa
Gene id: 3226
Gene name: HOXC10
Gene alias: HOX3I|MGC5259
Gene description: homeobox C10
Genbank accession: BC001293
Immunogen: HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN
Protein accession: AAH01293
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003226-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003226-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged HOXC10 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HOXC10 monoclonal antibody (M01), clone 3F2 now

Add to cart