| Brand: | Abnova |
| Reference: | H00003226-A02 |
| Product name: | HOXC10 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HOXC10. |
| Gene id: | 3226 |
| Gene name: | HOXC10 |
| Gene alias: | HOX3I|MGC5259 |
| Gene description: | homeobox C10 |
| Genbank accession: | BC001293 |
| Immunogen: | HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN |
| Protein accession: | AAH01293 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HOXC10 polyclonal antibody (A02), Lot # 060729QCS1 Western Blot analysis of HOXC10 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Transcriptome Analysis Revealed Unique Genes as Targets for the Anti-inflammatory Action of Activated Protein C in Human Macrophages.Pereira CP, Bachli EB, Schaer DJ, Schoedon G. PLoS One. 2010 Oct 15;5(10):e15352. |