View larger

HOXC10 polyclonal antibody (A02)

Reference:

Condition: New product

Data sheet of HOXC10 polyclonal antibody (A02)

Brand:	Abnova
Reference:	H00003226-A02
Product name:	HOXC10 polyclonal antibody (A02)
Product description:	Mouse polyclonal antibody raised against a partial recombinant HOXC10.
Gene id:	3226
Gene name:	HOXC10
Gene alias:	HOX3I\|MGC5259
Gene description:	homeobox C10
Genbank accession:	BC001293
Immunogen:	HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN
Protein accession:	AAH01293
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	HOXC10 polyclonal antibody (A02), Lot # 060729QCS1 Western Blot analysis of HOXC10 expression in Hela S3 NE ( Cat # L013V3 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Transcriptome Analysis Revealed Unique Genes as Targets for the Anti-inflammatory Action of Activated Protein C in Human Macrophages.Pereira CP, Bachli EB, Schaer DJ, Schoedon G. PLoS One. 2010 Oct 15;5(10):e15352.