Brand: | Abnova |
Reference: | H00003224-M02 |
Product name: | HOXC8 monoclonal antibody (M02), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXC8. |
Clone: | 1H2 |
Isotype: | IgG1 Kappa |
Gene id: | 3224 |
Gene name: | HOXC8 |
Gene alias: | HOX3|HOX3A |
Gene description: | homeobox C8 |
Genbank accession: | NM_022658 |
Immunogen: | HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS |
Protein accession: | NP_073149 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of HOXC8 transfected lysate using anti-HOXC8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXC8 MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |