Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXC8 monoclonal antibody (M01), clone 5G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about HOXC8 monoclonal antibody (M01), clone 5G1
| Brand: | Abnova |
| Reference: | H00003224-M01 |
| Product name: | HOXC8 monoclonal antibody (M01), clone 5G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXC8. |
| Clone: | 5G1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3224 |
| Gene name: | HOXC8 |
| Gene alias: | HOX3|HOX3A |
| Gene description: | homeobox C8 |
| Genbank accession: | NM_022658 |
| Immunogen: | HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS |
| Protein accession: | NP_073149 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Ratio of miR-196s to HOXC8 Messenger RNA Correlates with Breast Cancer Cell Migration and Metastasis.Li Y, Zhang M, Chen H, Dong Z, Ganapathy V, Thangaraju M, Huang S. Cancer Res. 2010 Oct 15;70(20):7894-904. Epub 2010 Aug 24. |