Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXC5 monoclonal antibody (M01), clone 1E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about HOXC5 monoclonal antibody (M01), clone 1E10
| Brand: | Abnova |
| Reference: | H00003222-M01 |
| Product name: | HOXC5 monoclonal antibody (M01), clone 1E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXC5. |
| Clone: | 1E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3222 |
| Gene name: | HOXC5 |
| Gene alias: | CP11|HOX3|HOX3D |
| Gene description: | homeobox C5 |
| Genbank accession: | NM_018953 |
| Immunogen: | HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR |
| Protein accession: | NP_061826.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Homeobox family Hoxc localization during murine palate formation.Hirata A, Katayama K, Tsuji T, Imura H, Natsume N, Sugahara T, Kunieda T, Nakamura H, Otsuki Y. Congenit Anom (Kyoto). 2015 Dec 31. [Epub ahead of print] |