Brand: | Abnova |
Reference: | H00003219-M29 |
Product name: | HOXB9 monoclonal antibody (M29), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB9. |
Clone: | 2E8 |
Isotype: | IgG2b Kappa |
Gene id: | 3219 |
Gene name: | HOXB9 |
Gene alias: | HOX-2.5|HOX2|HOX2E |
Gene description: | homeobox B9 |
Genbank accession: | NM_024017 |
Immunogen: | HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG |
Protein accession: | NP_076922.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |