HOXB9 monoclonal antibody (M29), clone 2E8 View larger

HOXB9 monoclonal antibody (M29), clone 2E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HOXB9 monoclonal antibody (M29), clone 2E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about HOXB9 monoclonal antibody (M29), clone 2E8

Brand: Abnova
Reference: H00003219-M29
Product name: HOXB9 monoclonal antibody (M29), clone 2E8
Product description: Mouse monoclonal antibody raised against a partial recombinant HOXB9.
Clone: 2E8
Isotype: IgG2b Kappa
Gene id: 3219
Gene name: HOXB9
Gene alias: HOX-2.5|HOX2|HOX2E
Gene description: homeobox B9
Genbank accession: NM_024017
Immunogen: HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Protein accession: NP_076922.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003219-M29-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003219-M29-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy HOXB9 monoclonal antibody (M29), clone 2E8 now

Add to cart