Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXB9 monoclonal antibody (M10), clone 2F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about HOXB9 monoclonal antibody (M10), clone 2F8
| Brand: | Abnova |
| Reference: | H00003219-M10 |
| Product name: | HOXB9 monoclonal antibody (M10), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB9. |
| Clone: | 2F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3219 |
| Gene name: | HOXB9 |
| Gene alias: | HOX-2.5|HOX2|HOX2E |
| Gene description: | homeobox B9 |
| Genbank accession: | NM_024017 |
| Immunogen: | HOXB9 (NP_076922.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTW |
| Protein accession: | NP_076922.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M10), clone 2F8. Lane 1: HOXB9 transfected lysate(28.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |