No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003219-M06A |
| Product name: | HOXB9 monoclonal antibody (M06A), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB9. |
| Clone: | 2E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3219 |
| Gene name: | HOXB9 |
| Gene alias: | HOX-2.5|HOX2|HOX2E |
| Gene description: | homeobox B9 |
| Genbank accession: | NM_024017 |
| Immunogen: | HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG |
| Protein accession: | NP_076922.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | HOXB9 monoclonal antibody (M06A), clone 2E9 Western Blot analysis of HOXB9 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |