| Brand: | Abnova |
| Reference: | H00003219-M05 |
| Product name: | HOXB9 monoclonal antibody (M05), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HOXB9. |
| Clone: | 4C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3219 |
| Gene name: | HOXB9 |
| Gene alias: | HOX-2.5|HOX2|HOX2E |
| Gene description: | homeobox B9 |
| Genbank accession: | NM_024017 |
| Immunogen: | HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG |
| Protein accession: | NP_076922.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HOXB9 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | A miR-192-EGR1-HOXB9 regulatory network controls the angiogenic switch in cancer.Wu SY, Rupaimoole R, Shen F, Pradeep S, Pecot CV, Ivan C, Nagaraja AS, Gharpure KM, Pham E, Hatakeyama H, McGuire MH, Haemmerle M, Vidal-Anaya V, Olsen C, Rodriguez-Aguayo C, Filant J, Ehsanipour EA, Herbrich SM, Maiti SN, Huang L, Kim JH, Zhang X, Han HD, Armaiz-Pena GN, Seviour EG, Tucker S, Zhang M, Yang D, Cooper LJ, Ali-Fehmi R, Bar-Eli M, Lee JS, Ram PT, Baggerly KA, Lopez-Berestein G, Hung MC, Sood AK. Nat Commun. 2016 Apr 4;7:11169. |