| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00003219-D03 |
| Product name: | HOXB9 MaxPab rabbit polyclonal antibody (D03) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HOXB9 protein. |
| Gene id: | 3219 |
| Gene name: | HOXB9 |
| Gene alias: | HOX-2.5|HOX2|HOX2E |
| Gene description: | homeobox B9 |
| Genbank accession: | NM_024017.4 |
| Immunogen: | HOXB9 (NP_076922.1, 1 a.a. ~ 250 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE |
| Protein accession: | NP_076922.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HOXB9 expression in transfected 293T cell line (H00003219-T01) by HOXB9 MaxPab polyclonal antibody. Lane 1: HOXB9 transfected lysate(28.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |