Brand: | Abnova |
Reference: | H00003217-M03 |
Product name: | HOXB7 monoclonal antibody (M03), clone 4C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB7. |
Clone: | 4C6 |
Isotype: | IgG1 Kappa |
Gene id: | 3217 |
Gene name: | HOXB7 |
Gene alias: | HHO.C1|HOX2|HOX2C|Hox-2.3 |
Gene description: | homeobox B7 |
Genbank accession: | NM_004502 |
Immunogen: | HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA |
Protein accession: | NP_004493 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo.Hui Li, Lu-Yan Shen, Wan-Pu Yan, Bin Dong , Xiao-Zheng Kang, Liang Dai, YongBo Yang, Hao Fu, He-Li Yang, Hai-Tao Zhou, Chuan Huang, Zhen Liang, HongChao Xiong, Ke-Neng Chen. PLoS One. 2015; 10(6): e0130551. |