Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HOXB7 monoclonal antibody (M01), clone 4F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HOXB7 monoclonal antibody (M01), clone 4F9
| Brand: | Abnova |
| Reference: | H00003217-M01 |
| Product name: | HOXB7 monoclonal antibody (M01), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB7. |
| Clone: | 4F9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3217 |
| Gene name: | HOXB7 |
| Gene alias: | HHO.C1|HOX2|HOX2C|Hox-2.3 |
| Gene description: | homeobox B7 |
| Genbank accession: | NM_004502 |
| Immunogen: | HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA |
| Protein accession: | NP_004493 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M01), clone 4F9. Lane 1: HOXB7 transfected lysate(23.97 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.di Pietro M, Lao-Sirieix P, Boyle S, Cassidy A, Castillo D, Saadi A, Eskeland R, Fitzgerald RC. Proc Natl Acad Sci U S A. 2012 Jun 5;109(23):9077-82. Epub 2012 May 17. |