Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00003211-M13 |
Product name: | HOXB1 monoclonal antibody (M13), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB1. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 3211 |
Gene name: | HOXB1 |
Gene alias: | HOX2|HOX2I|Hox-2.9|MGC116843|MGC116844|MGC116845 |
Gene description: | homeobox B1 |
Genbank accession: | NM_002144 |
Immunogen: | HOXB1 (NP_002135.2, 101 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF |
Protein accession: | NP_002135.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M13), clone 2E5. Lane 1: HOXB1 transfected lysate(25 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |