Brand: | Abnova |
Reference: | H00003211-M03 |
Product name: | HOXB1 monoclonal antibody (M03), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXB1. |
Clone: | 1E2 |
Isotype: | IgG1 Kappa |
Gene id: | 3211 |
Gene name: | HOXB1 |
Gene alias: | HOX2|HOX2I|Hox-2.9|MGC116843|MGC116844|MGC116845 |
Gene description: | homeobox B1 |
Genbank accession: | NM_002144 |
Immunogen: | HOXB1 (NP_002135, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV |
Protein accession: | NP_002135 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged HOXB1 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |