No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00003209-A01 |
Product name: | HOXA13 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HOXA13. |
Gene id: | 3209 |
Gene name: | HOXA13 |
Gene alias: | HOX1|HOX1J |
Gene description: | homeobox A13 |
Genbank accession: | NM_000522 |
Immunogen: | HOXA13 (NP_000513, 208 a.a. ~ 306 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL |
Protein accession: | NP_000513 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | HOXA13 polyclonal antibody (A01), Lot # 051026JC01 Western Blot analysis of HOXA13 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |