Brand: | Abnova |
Reference: | H00003198-M01 |
Product name: | HOXA1 monoclonal antibody (M01), clone 1E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HOXA1. |
Clone: | 1E10 |
Isotype: | IgG3 Kappa |
Gene id: | 3198 |
Gene name: | HOXA1 |
Gene alias: | BSAS|HOX1|HOX1F|MGC45232 |
Gene description: | homeobox A1 |
Genbank accession: | NM_005522 |
Immunogen: | HOXA1 (NP_005513.1, 11 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADV |
Protein accession: | NP_005513.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HOXA1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |