No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003176-M12A |
Product name: | HNMT monoclonal antibody (M12A), clone 2G24 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HNMT. |
Clone: | 2G24 |
Isotype: | IgG3 Kappa |
Gene id: | 3176 |
Gene name: | HNMT |
Gene alias: | HMT|HNMT-S1|HNMT-S2 |
Gene description: | histamine N-methyltransferase |
Genbank accession: | NM_006895 |
Immunogen: | HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
Protein accession: | NP_008826 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |