Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HNMT monoclonal antibody (M04A), clone 2G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HNMT monoclonal antibody (M04A), clone 2G12
| Brand: | Abnova |
| Reference: | H00003176-M04A |
| Product name: | HNMT monoclonal antibody (M04A), clone 2G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HNMT. |
| Clone: | 2G12 |
| Isotype: | IgG Mix Kappa |
| Gene id: | 3176 |
| Gene name: | HNMT |
| Gene alias: | HMT|HNMT-S1|HNMT-S2 |
| Gene description: | histamine N-methyltransferase |
| Genbank accession: | NM_006895 |
| Immunogen: | HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
| Protein accession: | NP_008826 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |