| Brand: | Abnova |
| Reference: | H00003172-M06 |
| Product name: | HNF4A monoclonal antibody (M06), clone 4D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HNF4A. |
| Clone: | 4D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3172 |
| Gene name: | HNF4A |
| Gene alias: | FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14 |
| Gene description: | hepatocyte nuclear factor 4, alpha |
| Genbank accession: | NM_000457 |
| Immunogen: | HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP |
| Protein accession: | NP_000448 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HNF4A is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |