Brand: | Abnova |
Reference: | H00003171-D01 |
Product name: | FOXA3 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FOXA3 protein. |
Gene id: | 3171 |
Gene name: | FOXA3 |
Gene alias: | FKHH3|HNF3G|MGC10179|TCF3G |
Gene description: | forkhead box A3 |
Genbank accession: | NM_004497.2 |
Immunogen: | FOXA3 (NP_004488.2, 1 a.a. ~ 350 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS |
Protein accession: | NP_004488.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of FOXA3 transfected lysate using anti-FOXA3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FOXA3 MaxPab mouse polyclonal antibody (B01) (H00003171-B01). |
Applications: | IP |
Shipping condition: | Dry Ice |