FOXA3 MaxPab mouse polyclonal antibody (B01) View larger

FOXA3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXA3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FOXA3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003171-B01
Product name: FOXA3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FOXA3 protein.
Gene id: 3171
Gene name: FOXA3
Gene alias: FKHH3|HNF3G|MGC10179|TCF3G
Gene description: forkhead box A3
Genbank accession: NM_004497.2
Immunogen: FOXA3 (NP_004488.2, 1 a.a. ~ 350 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Protein accession: NP_004488.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003171-B01-13-15-1.jpg
Application image note: Western Blot analysis of FOXA3 expression in transfected 293T cell line (H00003171-T01) by FOXA3 MaxPab polyclonal antibody.

Lane 1: FOXA3 transfected lysate(38.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOXA3 MaxPab mouse polyclonal antibody (B01) now

Add to cart